| Bottom - Summary - Details - PredictProtein | 
| PROF predictions for 9rnt | 
| SYNOPSIS of prediction for 9rnt | 
| sec str type | H | E | L | % in protein | 9.62 | 37.50 | 52.88 | 
| HEADER information | 
| ali_orig | 8rnt.msf | 
| ali_used | PROF1443438rnt.hssp | 
| %A: 6.7 | %C: 3.9 | %D: 5.8 | %E: 5.8 | %F: 3.9 | 
| %G: 11.5 | %H: 2.9 | %I: 1.9 | %K: 1.9 | %L: 2.9 | 
| %M: 0.0 | %N: 8.7 | %P: 3.9 | %Q: 1.9 | %R: 1.0 | 
| %S: 14.4 | %T: 5.8 | %V: 7.7 | %W: 1.0 | %Y: 8.7 | 
| prof_fpar | sec=/nfs/home1/yachdav/work/SNAP/prof/net/PROFsec_best.par | 
| prof_nnet | sec=2 | 
| AA : | amino acid sequence | 
| OBS_sec: | observed secondary structure: H=helix, E=extended (sheet), blank=other (loop) | 
| PROF_sec: | PROF predicted secondary structure: H=helix, E=extended (sheet), blank=other (loop) PROF = PROF: Profile network prediction HeiDelberg | 
| Rel_sec: | reliability index for PROFsec prediction (0=low to 9=high) Note: for the brief presentation strong predictions marked by '*' | 
| SUB_sec: | subset of the PROFsec prediction, for all residues with an expected average accuracy > 82% (tables in header) NOTE: for this subset the following symbols are used: L: is loop (for which above ' ' is used) .: means that no prediction is made for this residue, as the reliability is: Rel < 5 | 
| pH_sec: | 'probability' for assigning helix (1=high, 0=low) | 
| pE_sec: | 'probability' for assigning strand (1=high, 0=low) | 
| pL_sec: | 'probability' for assigning neither helix, nor strand (1=high, 0=low) | 
| ali_orig: | input file | 
| ali_used: | input file used | 
| prof_fpar: | name of parameter file, used [w] | 
| prof_nnet: | number of networks used for prediction [d] | 
| prof_skip: | note: sequence stretches with less than 9 are not predicted, the symbol '*' is used! | 
| BODY with predictions for 9rnt | 
PROF results (normal)....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10... AA ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT OBS_sec PROF_sec EEE EEE HHHHHHHHHH EE EEEE EEEEEEE EEEE EEEEE EEEEEEEE EEE Rel_sec 90111053000123577777302201014543455654543234332013205851444331145033056565534788156512335764023345044308 SUB_sec L.....L.......HHHHHH.........L...LLLL.L.............LLL.........L....LLLLLL..EEE.LLL....EEE......L.....L
PROF results (detail) ....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10... AA ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT pH_sec 1.0 pH_sec ..... 0.9 pH_sec ...... 0.8 pH_sec ........ 0.7 pH_sec ......... 0.6 pH_sec .......... 0.5 pH_sec ............ 0.4 pH_sec ............. ..... . . 0.3 pH_sec .................................... ......... ..... .. ... .... ...... 0.2 -------------------------------------------------------------------------------------------------------- pE_sec . 1.0 pE_sec ... . 0.9 pE_sec ... ... . 0.8 pE_sec . ..... . .... ...... ... 0.7 pE_sec ... ... ....... .. ..... ........ ... 0.6 pE_sec .... ... . ..... ....... .... ..... ........ ..... 0.5 pE_sec ..... .... .... ..... ........ .... ..... .......... ..... 0.4 pE_sec ..... ..... .... .. . .... ......... ......... ..... ...... ............ ..... 0.3 pE_sec ............ ...... ....................... ............................ .................... 0.2 -------------------------------------------------------------------------------------------------------- pL_sec . . 1.0 pL_sec . . . 0.9 pL_sec . ... ... ..... ... . . 0.8 pL_sec . . ... ........ .. ... .. ....... ... .... . 0.7 pL_sec . .. .. ................... ... ... ....... ... ..... .. 0.6 pL_sec .. ... . ... ..................... .... .... ........ ..... ....... .. 0.5 pL_sec ............ . ................................... . ..... ......... ........ ....... .. 0.4 pL_sec .............. ......................................................... ........ ............. 0.3 pL_sec ................. ............................................................ ........................ 0.2 --------------------------------------------------------------------------------------------------------
| Top - Summary - Details - PredictProtein |